Protein Info for HP15_2067 in Marinobacter adhaerens HP15

Annotation: DNA internalization-related competence protein ComEC/Rec2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 802 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 34 to 51 (18 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 295 to 314 (20 residues), see Phobius details amino acids 317 to 333 (17 residues), see Phobius details amino acids 340 to 358 (19 residues), see Phobius details amino acids 364 to 383 (20 residues), see Phobius details amino acids 390 to 408 (19 residues), see Phobius details amino acids 418 to 445 (28 residues), see Phobius details amino acids 452 to 471 (20 residues), see Phobius details amino acids 489 to 518 (30 residues), see Phobius details PF13567: DUF4131" amino acids 30 to 193 (164 residues), 87.9 bits, see alignment E=9.6e-29 TIGR00361: DNA internalization-related competence protein ComEC/Rec2" amino acids 151 to 765 (615 residues), 279.9 bits, see alignment E=3.6e-87 PF03772: Competence" amino acids 233 to 501 (269 residues), 172 bits, see alignment E=2.7e-54 TIGR00360: ComEC/Rec2-related protein" amino acids 254 to 434 (181 residues), 79.1 bits, see alignment E=4.9e-26 PF00753: Lactamase_B" amino acids 538 to 667 (130 residues), 45 bits, see alignment E=1.8e-15

Best Hits

Predicted SEED Role

"Predicted hydrolase of the metallo-beta-lactamase superfamily, clustered with KDO2-Lipid A biosynthesis genes" in subsystem KDO2-Lipid A biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRC2 at UniProt or InterPro

Protein Sequence (802 amino acids)

>HP15_2067 DNA internalization-related competence protein ComEC/Rec2 (Marinobacter adhaerens HP15)
MGPSGDSGSAALGVIAFSCGVILLYWLSILPPPTWLIAAIPLLALGRICVSPTFASSAFV
SALGIMVGLSWASWHASDRLSTVLPASLERERLSVSGYVCDIPSPGSFNSLRFSFCVTQW
HNLPIPTREEARMPDLLRLSWYGHGMERLPGQRLRLEVVLKRPHGSLNPAGFRYEDWLFR
KGYRATGSIRSVEVDRDVGCFVHCQYRKLHRLLHQWTIEQFGGARHFPLVSSLLIGHRGH
MEQKHWDVLKATGTIHLVAISGLHLGLIALGAGFLCRRLLLTVPAHIVSDSSRRWFAFLA
VILCCLVYALAAGFTVPTQRALVMVVAGGWLVLMSRQAPVWNVFLAALAAVLVLDPFAPL
DQGFWLSFAAVATLITVFSSRLAGTGWLRGLVLAQLAVFGGLWPILEILGQGQPLVGLLA
NLVAIPWVSLVVMPVLVAGGLLAAVVPGAAQLFLPIFDLTLGVLWQWLMWLAQWQAPDIP
AGVPELVGWALLSVSVLCLPFAMFRLVAVLSAVLWLVYPAPSSERNSYVAEPVVRVWDVG
QGLSVLVRHGREVLVYDTGPAVPGVFSAVESTLLPNLAAEGIKRIDTLVISHADSDHAGG
ISELSRNVSVGRVIAGEPAAVRQQVGELPVQACKQAEDRLGGLVLEFWQGEGAQEGNDAS
CVLRIYHPDSGTEWLLPGDITEPVEAEYLAYMAGREDVQVPSNRVLVAPHHGSKTSSSEP
WVRVLRPDRVIYTAGYRHRYGHPHPTVTARYAGVGAVPLNTACSGSVEMTVVDKKLVLKE
MRHGSSFWVGGSGLARDQCKIP