Protein Info for PGA1_c21430 in Phaeobacter inhibens DSM 17395

Annotation: putative permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 12 to 42 (31 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 202 to 226 (25 residues), see Phobius details amino acids 230 to 259 (30 residues), see Phobius details amino acids 266 to 282 (17 residues), see Phobius details amino acids 302 to 333 (32 residues), see Phobius details PF01594: AI-2E_transport" amino acids 15 to 334 (320 residues), 197.9 bits, see alignment E=1.5e-62

Best Hits

KEGG orthology group: None (inferred from 71% identity to sil:SPO1119)

Predicted SEED Role

"Putative permease often clustered with de novo purine synthesis" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ENK9 at UniProt or InterPro

Protein Sequence (355 amino acids)

>PGA1_c21430 putative permease (Phaeobacter inhibens DSM 17395)
MALPAQKQMKYWGIAAVVIAVVLWALGDVLLPFVLGAAIAYLIDPIADRLESMGLSRTAA
TAVITVFAMLLFVVILLVVVPTLIYQMLDLAKVLPEAFKNLRDFVQQQAPSLFDEGSRAQ
QTIVSIAQTLQSKAIGVLEGVVGSAVSLVNVLILFVIVPVVAVYLLLDWDRMVARIDELL
PRDHAPTIRELAARIDKVLASFIRGMGTVCLILGTYYAVALMLVGLNFGLAVGFIAGLVT
FIPYLGALIGGVLAIGLALFQFWGDWWSIGMVAGVFAIGQVIEGNFLTPKLVGNSVGLHP
VWLLLALSVFGALFGFVGMLIAVPVAAALGVIARFLVEQYLDSRLYQGKAHNDAD