Protein Info for HP15_210 in Marinobacter adhaerens HP15

Annotation: phospholipase A(1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF02253: PLA1" amino acids 112 to 371 (260 residues), 326.6 bits, see alignment E=6.2e-102

Best Hits

KEGG orthology group: K01058, phospholipase A1 [EC: 3.1.1.32] (inferred from 72% identity to maq:Maqu_0459)

Predicted SEED Role

"Phospholipase A1 precursor (EC 3.1.1.32, EC 3.1.1.4); Outer membrane phospholipase A"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PK43 at UniProt or InterPro

Protein Sequence (375 amino acids)

>HP15_210 phospholipase A(1) (Marinobacter adhaerens HP15)
MTSPHLLAPPTAITTLSLMLSVPVNVSAQTEEAPSIDSPEQCALIDDGIKRLACFDSLYK
PTESQAQASESAKEQAEKSAEQLAPNGKDLDAVAGSALEGDSDAGVMSALVDRYVAAEKA
VFSFSGSFVGHRPTYILPVSWVKDPNESPSSPRLGSIGYDYDLEREEAKYQISFKVPLLT
GILDDRTTLWFGYTQTSFWQVYNQDDSAPFRETNYEPEIFARYQTDWDIGPGRLNGVTLG
FNHQSNGQSEPRSRSWNRIMGSAAYSYDRWLFMVQPWYRIPENNDDDNVDIQRYLGYANY
HAVYKLTEDRTFSLRLMNNLRSDDNKTSVEFGYSFPMGDTVKGFFQYYNGYGESLIDYNH
RIQRFGIGIMLNDWL