Protein Info for PGA1_c21410 in Phaeobacter inhibens DSM 17395

Annotation: lipoprotein-releasing system transmembrane protein LolC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 28 to 52 (25 residues), see Phobius details amino acids 287 to 311 (25 residues), see Phobius details amino acids 332 to 361 (30 residues), see Phobius details amino acids 396 to 414 (19 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 10 to 430 (421 residues), 373.4 bits, see alignment E=7.4e-116 PF12704: MacB_PCD" amino acids 32 to 249 (218 residues), 61.9 bits, see alignment E=1.1e-20 PF02687: FtsX" amino acids 290 to 423 (134 residues), 47.1 bits, see alignment E=2.3e-16

Best Hits

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 81% identity to sit:TM1040_1846)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DS00 at UniProt or InterPro

Protein Sequence (430 amino acids)

>PGA1_c21410 lipoprotein-releasing system transmembrane protein LolC (Phaeobacter inhibens DSM 17395)
MATPLPFSRFEWLIAWRYLRARRAEGGVSVMTWISLIGIALAVFALIATLAVRTGFRSEF
VGTILGANAHVTLYSHGTVTEQGQIDRKLTEYDALAEAAAAVPGVIRTAPLIKGQVMASL
RQRSAGVEVFGISAANIATLPGIAQSEAAIGDLSRFDEGVALGSGVARELGVSVGDRIKL
ISPNGVKTAFGTSPRVNAYEVVYIFTAGRYDIDRTRLYMPFAEAQSYFNREGYADEIEVM
VEDPETVDRMVLPLLQAGDQVTSGIGVWTWRDASGGFLRALEVEDNVMFIILSILVLIAT
MNIVSGLIMLVKNKGRDIGILRTIGLSEGSVMRVFFLCGACTGVVGTLLGVILGCLFAIY
IDPIFSFVNYVMGGGVWDPAIRGIYALPAELRLADVLSAVALSLTLSFVITIFPARRAAR
MNPVEALRYE