Protein Info for Psest_2150 in Pseudomonas stutzeri RCH2

Annotation: DNA polymerase LigD, polymerase domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 TIGR02778: DNA ligase D, polymerase domain" amino acids 16 to 260 (245 residues), 273.7 bits, see alignment E=7.8e-86 PF21686: LigD_Prim-Pol" amino acids 32 to 285 (254 residues), 280.5 bits, see alignment E=1.4e-87 PF01896: DNA_primase_S" amino acids 135 to 255 (121 residues), 30.7 bits, see alignment E=4e-11

Best Hits

KEGG orthology group: None (inferred from 84% identity to psa:PST_2161)

Predicted SEED Role

"ATP-dependent DNA ligase (EC 6.5.1.1) clustered with Ku protein, LigD" in subsystem DNA Repair Base Excision (EC 6.5.1.1)

Isozymes

Compare fitness of predicted isozymes for: 6.5.1.1

Use Curated BLAST to search for 6.5.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMY5 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Psest_2150 DNA polymerase LigD, polymerase domain (Pseudomonas stutzeri RCH2)
MPAKRKSTERPLVGGIGISNPQRVIDAATGTTKFALAEYYLSVADWLVPQLAGRPLSIVR
APEGIGGESFFQRHCGRLKMPHMRALPKDLDPEHARLIQADNITAVLEAVQMGSVEFHTW
NARSDRIERPDRVIFDLDPDPALPWSRMIDTTELTLALLDELGLRAFLKTSGGRGMHVVV
PIERRHDWDCVRSFAQGVTQRLGRQHPERIACKMGAQNRVGRIFVDYLRNQRGASTVAAF
SVRARPGLGVSLPVSLDEMRQLEGADQWRLGNARAYLSERGADPWAEYGSTRQRLTSTLL
ETLRKEG