Protein Info for Psest_2147 in Pseudomonas stutzeri RCH2

Annotation: NADPH:quinone reductase and related Zn-dependent oxidoreductases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF08240: ADH_N" amino acids 28 to 88 (61 residues), 35.7 bits, see alignment E=9.7e-13 PF00107: ADH_zinc_N" amino acids 159 to 265 (107 residues), 75.4 bits, see alignment E=6.4e-25 PF13602: ADH_zinc_N_2" amino acids 189 to 335 (147 residues), 66 bits, see alignment E=1.1e-21

Best Hits

KEGG orthology group: None (inferred from 98% identity to psa:PST_2164)

Predicted SEED Role

"Alcohol dehydrogenase, zinc-containing" in subsystem D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL02 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Psest_2147 NADPH:quinone reductase and related Zn-dependent oxidoreductases (Pseudomonas stutzeri RCH2)
MSRIIRFHQFGPADVLRHEERAVPVAGPGEVLIGVRAIGVSWNDVLWRQDLAPRHARLPA
GLGSEVAGEVLAVGEGVQGFSVGDQVAGFPAHDLNQYPLYAEHALLPQQALVHYPDMLDA
SEAAIHYTPMLVSYFALVELAQLEPGQYVLINQAAHCTGPAAVQLAKALGGRVIATCDTS
EDRDYLRELGAETVIVTEEEDLVGRLQKLTEGRGVEVVLDACGGSQMKLLGDVMAPLGKL
ILYGMNGGNETALPVCAAFKKNFKFFLHCLCDFTGQPELGIEQNREAVERALQHINQLTA
DRLLRPQVDRLFPFEQAVEAHRYVESGIPRGRVVLTLG