Protein Info for Psest_2145 in Pseudomonas stutzeri RCH2

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00529: CusB_dom_1" amino acids 37 to 355 (319 residues), 27 bits, see alignment E=7.2e-10 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 39 to 369 (331 residues), 265.9 bits, see alignment E=2.1e-83 PF13533: Biotin_lipoyl_2" amino acids 63 to 112 (50 residues), 41.9 bits, see alignment 1.3e-14 PF16576: HlyD_D23" amino acids 64 to 288 (225 residues), 54.4 bits, see alignment E=2.2e-18

Best Hits

Swiss-Prot: 35% identical to BEPF_BRUSU: Efflux pump periplasmic linker BepF (bepF) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: None (inferred from 96% identity to psa:PST_2166)

Predicted SEED Role

"Multidrug efflux membrane fusion protein MexE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMY0 at UniProt or InterPro

Protein Sequence (409 amino acids)

>Psest_2145 RND family efflux transporter, MFP subunit (Pseudomonas stutzeri RCH2)
MERSFNALRFPLIALTVLITAACGKAPEATQSGMPPPAVSVAEVIEQQVTEWDELTGRLE
APESVEIRPRVSGFIDKAAFEEGALVKKGDLLFQIDPRPFQAEVKRLQAQLQQARAIQQR
TVAEAERGERLRQKNAISAELADARVSAASEARSATAAIQAQLDRAQLDLSFTRVTAPID
GRVGRALITSGNLVNASEALLTTLVSTDKVYAYFEADERTYLKYRELARNGDRGETTPVY
LGLSSEDGHPHLGHMDFVDNQVDPRTGTIRGRAVFDNRDGSFTPGLYARLKLVGSATYDA
VLIKDVAVGTDLGKKFVLVLAEDGTVAYRPVELGPKLEGLRIVRSGLAKGESIVVNGLQR
VRPGSPVQPESVPMADAETLATLRQQNRAISEAMKPQVVERTLAQRPSS