Protein Info for HP15_2056 in Marinobacter adhaerens HP15

Annotation: transcriptional regulator of AsnC/Lrp family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 PF13404: HTH_AsnC-type" amino acids 11 to 52 (42 residues), 61.8 bits, see alignment E=1.1e-20 PF13412: HTH_24" amino acids 12 to 57 (46 residues), 73.4 bits, see alignment E=2.2e-24 PF01047: MarR" amino acids 17 to 60 (44 residues), 29.7 bits, see alignment E=1.2e-10 PF01037: AsnC_trans_reg" amino acids 77 to 152 (76 residues), 87.8 bits, see alignment E=9.2e-29

Best Hits

Swiss-Prot: 44% identical to BKDR_PSEPU: Bkd operon transcriptional regulator (bkdR) from Pseudomonas putida

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 92% identity to maq:Maqu_1733)

Predicted SEED Role

"Transcriptional regulator BkdR of isoleucine and valine catabolism operon" in subsystem Isoleucine degradation or Valine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRB1 at UniProt or InterPro

Protein Sequence (165 amino acids)

>HP15_2056 transcriptional regulator of AsnC/Lrp family protein (Marinobacter adhaerens HP15)
MTENKKTLAKIDKMDRRILEQIQQDGSLTNQELAEKVGLSPSPCLRRVRALEDAGIIVRT
VTILDHKKLGLSLTAIILIGMDRHTPERFAAFEEQVAEYPEVQECYLITGQDADYMLKVV
VPDMDHYHHFLLNRITRIQGVSGVHSSFVLRRVIDSTALPLGYLS