Protein Info for Psest_2138 in Pseudomonas stutzeri RCH2

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 58 to 386 (329 residues), 263.3 bits, see alignment E=1.3e-82 PF13533: Biotin_lipoyl_2" amino acids 83 to 131 (49 residues), 54.7 bits, see alignment 1e-18 PF16576: HlyD_D23" amino acids 84 to 305 (222 residues), 33 bits, see alignment E=5.6e-12 PF13437: HlyD_3" amino acids 194 to 299 (106 residues), 27.7 bits, see alignment E=5.6e-10

Best Hits

Swiss-Prot: 50% identical to MDTA_PANAA: Multidrug resistance protein MdtA (mdtA) from Pantoea ananatis (strain AJ13355)

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 93% identity to psa:PST_2177)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLL6 at UniProt or InterPro

Protein Sequence (413 amino acids)

>Psest_2138 RND family efflux transporter, MFP subunit (Pseudomonas stutzeri RCH2)
MSEAHSNPARFSPRWLLLILAVAAIGLLVWWLWPAPQETPQRPGGRPGFGAFGGPVPVRV
AKVEQGEFEVFNKALGSVTPLNTVNLRSRVGGELVELRFEEGQRVKKGDLLAVIDPRPYK
VALQQAEGTLQQNRAQLKNAQVDFERYRGLFADDSIAKQTLDTQEALVSQYQGTLAANQA
SVNEARLNLEFTQIRSPIDGRVGLRQLDVGNLVAANDTTPLVVITQTQPMSISFTLPEGD
LLPVLTRYRQGDKLAVQIWDRGEKLMFGEGLLESIDNQIDATTGTLRLKARFDNEQELLI
PNQFVNVRLRVETLSDAVLIPSAALQFGSRGTFAYVVGEDNKVQLRLLKAGPSNGETTVV
LEGLEVGERVVMEGTDRLRDGAEVEVVGSRRMAEEAAENPVLGGDEAAEREAQ