Protein Info for HP15_2048 in Marinobacter adhaerens HP15

Annotation: UDP-glucose 4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 1 to 178 (178 residues), 60.9 bits, E=3.9e-20
• TIGR01179: UDP-glucose 4-epimerase GalE
  • amino acids 2 to 321 (320 residues), 463.5 bits, E=1.5e-143
• PF01370: Epimerase
  • amino acids 3 to 251 (249 residues), 204.4 bits, E=6.8e-64
• PF02719: Polysacc_synt_2
  • amino acids 3 to 173 (171 residues), 61.1 bits, E=3.8e-20
• PF16363: GDP_Man_Dehyd
  • amino acids 4 to 306 (303 residues), 172.9 bits, E=4.5e-54
• PF01073: 3Beta_HSD
  • amino acids 4 to 246 (243 residues), 65.7 bits, E=1.3e-21
• PF13460: NAD_binding_10
  • amino acids 7 to 167 (161 residues), 38.2 bits, E=4.9e-13
• PF07993: NAD_binding_4
  • amino acids 58 to 179 (122 residues), 31.6 bits, E=3.4e-11

Best Hits

Swiss-Prot: 56% identical to EXOB_AZOBR: UDP-glucose 4-epimerase (exoB) from Azospirillum brasilense

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 89% identity to maq:Maqu_1711)

MetaCyc: 45% identical to UDP-6-deoxy-5,6-ene-GlcNAc 4-epimerase (Streptomyces chartreusis)
5.1.3.M3 [EC: 5.1.3.M3]; UDP-N-acetylglucosamine 4-epimerase. [EC: 5.1.3.M3, 5.1.3.7]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• colanic acid building blocks biosynthesis (8/11 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (3/9 steps found)
• tunicamycin biosynthesis (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.7 or 5.1.3.M3

Sequence Analysis Tools

See E4PRA3 at UniProt or InterPro

Protein Sequence (342 amino acids)

>HP15_2048 UDP-glucose 4-epimerase (Marinobacter adhaerens HP15)
MKVLVTGGAGYIGSHVVRQLGQAGHDIVVFDNLSTGYRWAVTAGELVVGDLADEAAIEDL
FSRHQFEAVLHFAANIVVPESVANPLKYYSNNTRNTLNLLKAVEKHEVPYMVFSSTAAVY
GMPEQTVLTEDLPLAPINPYGASKMMSERMIMDLAAASSLNYVILRYFNVAGANPEGLLG
QATPEATHLIKVACECVTEQREGMSVFGTDYDTRDGTCIRDYIHVEDLAKAHVMALDYMA
DGGHSKVMNCGYGRGFTVREVIDVVKAQSGVDFPVTETGRRAGDPAALMADNTLIRQTLG
WQPDYDNLDTIVGTALAWEAIWQKKKLTTPHNFSVFVSGFNG