Protein Info for Psest_2136 in Pseudomonas stutzeri RCH2

Annotation: Predicted homoserine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03447: NAD_binding_3
  • amino acids 13 to 101 (89 residues), 28.7 bits, E=1.8e-10
• PF21135: DRL_cat
  • amino acids 119 to 279 (161 residues), 127 bits, E=7.4e-41

Best Hits

KEGG orthology group: None (inferred from 94% identity to psa:PST_2179)

Predicted SEED Role

"Homoserine dehydrogenase (EC 1.1.1.3)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 1.1.1.3)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.3

Use Curated BLAST to search for 1.1.1.3

Sequence Analysis Tools

See L0GMQ6 at UniProt or InterPro

Protein Sequence (410 amino acids)

>Psest_2136 Predicted homoserine dehydrogenase (Pseudomonas stutzeri RCH2)
MPTSEIKRIGVSGTGMIARGFIRLIRNHYPDMQISRVLTRRPLSSMADFPLADALTNSLD
ELIDHSDLVVECSGDVFHGTSVIERAFEAGLKVVTVNAELQVTTGSYLAGKGFLTEAEGD
QPGSLAALREDALQMGFEPLVYGNMKGYLNHDPSPEDMAYWANRQGISIDQTTSFTDGTK
VQIEQVIIGNGLGATITRQGMEGLASTNLDDSASLLGMLAERAGQPIVDYVIPSGYPAGG
VFLVGKHDEDQARAIEYFKLGRGPFYTLVRPFHLCSLEVGKTVRRVLNGGGVLLNNSTEP
TLGVAAIAKRAMKPGELIERGIGGFQFRGEAIKLAQHPDHVPIGLLRKTALKRAVEPGQI
ITFDDIDILPSRALDIVMEQRKPRLVEVESKADAWTTPSINTMGMLAFGG