Protein Info for Psest_2136 in Pseudomonas stutzeri RCH2

Annotation: Predicted homoserine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 PF03447: NAD_binding_3" amino acids 13 to 101 (89 residues), 28.6 bits, see alignment E=2e-10 PF21135: DRL_cat" amino acids 119 to 279 (161 residues), 128 bits, see alignment E=3.7e-41

Best Hits

KEGG orthology group: None (inferred from 94% identity to psa:PST_2179)

Predicted SEED Role

"Homoserine dehydrogenase (EC 1.1.1.3)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 1.1.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.3

Use Curated BLAST to search for 1.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMQ6 at UniProt or InterPro

Protein Sequence (410 amino acids)

>Psest_2136 Predicted homoserine dehydrogenase (Pseudomonas stutzeri RCH2)
MPTSEIKRIGVSGTGMIARGFIRLIRNHYPDMQISRVLTRRPLSSMADFPLADALTNSLD
ELIDHSDLVVECSGDVFHGTSVIERAFEAGLKVVTVNAELQVTTGSYLAGKGFLTEAEGD
QPGSLAALREDALQMGFEPLVYGNMKGYLNHDPSPEDMAYWANRQGISIDQTTSFTDGTK
VQIEQVIIGNGLGATITRQGMEGLASTNLDDSASLLGMLAERAGQPIVDYVIPSGYPAGG
VFLVGKHDEDQARAIEYFKLGRGPFYTLVRPFHLCSLEVGKTVRRVLNGGGVLLNNSTEP
TLGVAAIAKRAMKPGELIERGIGGFQFRGEAIKLAQHPDHVPIGLLRKTALKRAVEPGQI
ITFDDIDILPSRALDIVMEQRKPRLVEVESKADAWTTPSINTMGMLAFGG