Protein Info for Psest_2132 in Pseudomonas stutzeri RCH2

Annotation: Outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 transmembrane" amino acids 36 to 54 (19 residues), see Phobius details PF17243: POTRA_TamA_1" amino acids 57 to 128 (72 residues), 61.7 bits, see alignment E=9e-21 PF07244: POTRA" amino acids 217 to 273 (57 residues), 34.6 bits, see alignment 4e-12 PF01103: Omp85" amino acids 310 to 601 (292 residues), 114.5 bits, see alignment E=1.1e-36

Best Hits

KEGG orthology group: K07278, outer membrane protein (inferred from 93% identity to psa:PST_2184)

Predicted SEED Role

"Uncharacterized protein YtfM precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKZ3 at UniProt or InterPro

Protein Sequence (604 amino acids)

>Psest_2132 Outer membrane protein (Pseudomonas stutzeri RCH2)
MPVPPQSHLTDCLTSGFRHPREPVLALRAMCKSNRIGPLVAAVLMLSGISAGAAELDVRI
EPQSRALRENIENYIGDLGDRDANELLRYSRVAQRQAEKALQALGYYRSRIRTDVREGDE
PTLVLRVQTGEPVRLRNITVRLDGPAAEFSGFRVAQRTLRQGDVLNHGRYEDVKQQFLNQ
ASRYGYFDGRFTRQRLAVDPRENTADVELVFDSGPRYRLGDVRFEGDAPFDDDLLRRMVP
FDADTPYDSELIAELSQALQSSGYFEGVRVDANPTSASEQRIPVAVALTTRKPRTFGLGL
GYSTDVGPRVRLNWTRHWVNPQGHSYGAETELSAPRQNVGLWYDIPLDPPLTDKLRFVGG
YQYEEIAGTDTLSRLLKVGPEWHSRLPSGWLRVVSLKWQHEEYKLGDDSGISTLLMPGIA
YSYLRSDNRIDPSNGYRLQFEVAAAKSGVLSDADLVHANVLLRGLTTLGQRHRFLGRVQL
GGNWTDEYVNVPPSLRYFAGGDQSVRGYDYQSLSPTNSDGDKIGGRYQFAVSAEYQYSIA
EKWRVATFVDQGNAFNSLEIPTLKSAVGVGVRWVSPVGPIRVDLAHPLDSEGGVRLHFSM
GPEL