Protein Info for PGA1_c21220 in Phaeobacter inhibens DSM 17395

Annotation: transcriptional regulator, MarR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF12802: MarR_2" amino acids 51 to 107 (57 residues), 36 bits, see alignment E=1.3e-12 PF13463: HTH_27" amino acids 52 to 116 (65 residues), 53 bits, see alignment E=6.7e-18 PF22381: Staph_reg_Sar_Rot" amino acids 60 to 120 (61 residues), 31.1 bits, see alignment E=4.2e-11

Best Hits

KEGG orthology group: None (inferred from 89% identity to sit:TM1040_1731)

Predicted SEED Role

"Transcriptional regulator, MarR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EY65 at UniProt or InterPro

Protein Sequence (167 amino acids)

>PGA1_c21220 transcriptional regulator, MarR family (Phaeobacter inhibens DSM 17395)
MRMSMEMPIGQQDTKGFMTGYLEALAMVERLHRLLLDVIKDEFERVGVLEINAVQALLLF
NIGNNEVTAGELKSRGYYQGSNVSYNLKKLVEMGYMHHQRCEIDRRSVRVRLTERGREIR
DIVAALFSRHAEGLEGKGVISGDGIADITTALKRVERYWSDQIRYIY