Protein Info for PGA1_c21210 in Phaeobacter inhibens DSM 17395

Annotation: putative lactoylglutathione lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00903: Glyoxalase
  • amino acids 6 to 120 (115 residues), 73.6 bits, E=1.9e-24
• PF13669: Glyoxalase_4
  • amino acids 7 to 105 (99 residues), 51.9 bits, E=8.8e-18

Best Hits

Swiss-Prot: 42% identical to LGUL_SYNY3: Probable lactoylglutathione lyase (gloA) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01759, lactoylglutathione lyase [EC: 4.4.1.5] (inferred from 87% identity to sit:TM1040_1730)

MetaCyc: 36% identical to lactoylglutathione lyase (Escherichia coli K-12 substr. MG1655)
Lactoylglutathione lyase. [EC: 4.4.1.5]

Predicted SEED Role

"Lactoylglutathione lyase (EC 4.4.1.5)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 4.4.1.5)

MetaCyc Pathways

• methylglyoxal degradation VIII (3/3 steps found)
• methylglyoxal degradation I (2/3 steps found)
• superpathway of methylglyoxal degradation (3/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.5

Use Curated BLAST to search for 4.4.1.5

Sequence Analysis Tools

See I7DRY7 at UniProt or InterPro

Protein Sequence (142 amino acids)

>PGA1_c21210 putative lactoylglutathione lyase (Phaeobacter inhibens DSM 17395)
MPLKYLHTMVRVKDLEKSMAFYALLGLKETKRYDSEKGRFSLIFMAAEGQEDTPIELTYN
WDGDDALPSDSRHFGHLAYGVDDIYATCQHLMDNGVTINRPPRDGHMAFVRSPDNISIEL
LQNGDALDPAEPWASMENTGSW