Protein Info for PGA1_c21180 in Phaeobacter inhibens DSM 17395

Annotation: thymidylate synthase ThyA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03284: thymidylate synthase
  • amino acids 3 to 85 (83 residues), 121.8 bits, E=1.6e-39
  • amino acids 84 to 277 (194 residues), 270.6 bits, E=7.8e-85
• PF00303: Thymidylat_synt
  • amino acids 3 to 277 (275 residues), 391.2 bits, E=1e-121

Best Hits

Swiss-Prot: 84% identical to TYSY_RUEST: Thymidylate synthase (thyA) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 84% identity to sit:TM1040_1729)

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• folate transformations III (E. coli) (9/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• folate transformations II (plants) (10/11 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (8/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• pyrimidine deoxyribonucleosides salvage (4/5 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)

KEGG Metabolic Maps

• One carbon pool by folate
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.45

Sequence Analysis Tools

See I7ENJ0 at UniProt or InterPro

Protein Sequence (277 amino acids)

>PGA1_c21180 thymidylate synthase ThyA (Phaeobacter inhibens DSM 17395)
MRQYHEALQYILDHGEVSSDRTGTGTISCFGMQTRYPLADGFPLVTTKKLHLRSIIHELL
WFLSGDTNIGYLKDNGVSIWDEWADENGDLGPVYGHQWRHFPRLELAEGTTGEEPLYRAG
TVDQIANLVDMIRNSPDSRRLIVTAWNPGDVPDMALPPCHTLWQVRVQGRRMHLQLYQRS
ADMFLGVPFNIASYALLLKMLAHVTGYEAGDFIHTIGDAHIYSNHMDQVKLQLSRRPQPL
PELRINRDVSSIFEFRYEDFDVLNYTPDPGIKAPVAV