Protein Info for PGA1_c21090 in Phaeobacter inhibens DSM 17395

Annotation: putative nitrilotriacetate monooxygenase component B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF01613: Flavin_Reduct" amino acids 14 to 156 (143 residues), 155.2 bits, see alignment E=7.5e-50

Best Hits

Swiss-Prot: 52% identical to Y0793_RHIME: Probable flavin reductase (SMa0793) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 52% identity to smd:Smed_6253)

Predicted SEED Role

"Nitrilotriacetate monooxygenase component B (EC 1.14.13.-)" in subsystem Aromatic Amin Catabolism (EC 1.14.13.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E261 at UniProt or InterPro

Protein Sequence (307 amino acids)

>PGA1_c21090 putative nitrilotriacetate monooxygenase component B (Phaeobacter inhibens DSM 17395)
MTSLDPRALRHAFGSFMTGVTVVTSHDQSGQPIGFTANSFTSVSLDPPLVLVCLANQSRN
YDALVNGGGFAVNVLAETQIEISNTFARPAEDRFAGVNWHKGPAGSPLIDGVSAWFDCSL
HKTVEAGDHVILIGEVKAFDVSPHPGLGYARGAYVTAATTAEPAGTGPDLVVSALIERNG
EVLLVDDGQGGATLPEALAGPDGASATVRQLIADTGLTAEPGFVYSVFEDVARKRQHIAF
LCQAGAGAPTRGTFVPLAQDGAGEAGLEDISDPAILIMLERFAREATLGDFGIYSGNQRS
GEIRQIA