Protein Info for HP15_2031 in Marinobacter adhaerens HP15

Annotation: putative Zn-dependent protease, contains TPR repeats

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01435: Peptidase_M48" amino acids 65 to 169 (105 residues), 60.3 bits, see alignment E=6.9e-20 PF13432: TPR_16" amino acids 280 to 332 (53 residues), 19.8 bits, see alignment 2.7e-07 amino acids 339 to 401 (63 residues), 16.2 bits, see alignment E=3.7e-06 PF14559: TPR_19" amino acids 345 to 409 (65 residues), 35.3 bits, see alignment E=3.6e-12

Best Hits

Predicted SEED Role

"Exported zinc metalloprotease YfgC precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQS5 at UniProt or InterPro

Protein Sequence (476 amino acids)

>HP15_2031 putative Zn-dependent protease, contains TPR repeats (Marinobacter adhaerens HP15)
MAITALLALLLFSMPSHAQENRLPSIGGSGGGLIAGQQESDIGQQVMVSIRRSAPRISDP
LVYDYLSAITYRLVPSAPLQNRDLTLALIDSPAINAFAVPGGIVGVNGGLFLNAATEQQF
ASVLAHELAHLSQRHFARRMEQQETSAPLTLAGMIAGIVLSAVTQSDIGLPPLPGPRRWP
PRTCSPTAAPMNRKPTGSGWTFWPAPGWTLAACRKCLKSMRQNRMQGNRLPEYLSTHPLT
QSRVADTRNRAEQYPDENIRDGQEYHLMRSRLQVHYAPSPDVAVETFEAYLDRPDAQRND
AIRYGLSVAYLEDRQYEKAVDILNDLLATNPGRITFQVTLAEVRLAQDRVDEARSILKDA
LARNPGNYPITHTLALTEIADGNGAAAAEHLKQLTRQLPGQEHLWLKLAEAEGMARNIVG
VHRARAEYDVLMGDLESAQRQLRQAQEKLPAGAPQRQIVTERLAEITSRLHARANS