Protein Info for Psest_2116 in Pseudomonas stutzeri RCH2

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 703 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF07715: Plug" amino acids 67 to 166 (100 residues), 63.5 bits, see alignment E=2.4e-21 TIGR01783: TonB-dependent siderophore receptor" amino acids 69 to 701 (633 residues), 398.2 bits, see alignment E=4e-123 PF00593: TonB_dep_Rec" amino acids 239 to 671 (433 residues), 241.2 bits, see alignment E=4.3e-75

Best Hits

Swiss-Prot: 64% identical to CNTO_PSEAB: Metal-pseudopaline receptor CntO (cntO) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 72% identity to avn:Avin_51930)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMN5 at UniProt or InterPro

Protein Sequence (703 amino acids)

>Psest_2116 TonB-dependent siderophore receptor (Pseudomonas stutzeri RCH2)
MNNASAVLKWVGCGAALILAGAPLAIAKEAAVLDSVTITADQERADGPVQGYRAKRTRSA
TKTDTPIEEIPQSISVIPASVLQDLDSPRAEKALDFAGGVARQNDFGGLTMYEYSVRGLT
TGEFYKDGFSVNRGFMNPPDASNIERVEVLKGPSASLYGRGDPGGTINIVSKRPQLDSFA
RLDLSAGRWDRYRTALDVNTPLDEDGNMLYRMNIAVEDGNSFRDHREAERQFVAPSFSWE
LSPDTRLLVQAEVVRNRQTFDRGVVAPGGDLGKVSRSAFYGEPSDGPISNDNETLQAELE
HDLNEVWTLRLASHYKQGRMDGYATEAAAVADDDRTLTRNLRYRDYDWQDAITQLELRGR
FDTGSIEHQLLIGTEYERYALSEFMLRSNNLRNIDLYNPVYGAPRPAFNPARTVDRNELV
HSRALNLQDQIRFTDKLFGVIGARYDHYEQRLDNEVAGRRTEQTHEKVTPRVGVLYQLVP
EVGLFANASQSFKPNNGADFSGATFDPEEGVGYEAGVKLDLFDGRLGLTAAAFHLTKENV
LTSDPANDGFQIAAGEVRSRGIDLQLAGQLTDAIRVIGGYAYVDAEVTRDNTLASGSRLL
NVPRHSGSLLTTYEFLDGDLSGLSLGGAVNYVGDRAGQADSDFELPSYTTVDLLARYKAT
EKLTLGMNLNNAFDRTYYERSYSNVWVMPGEPRNLSVSLSVEL