Protein Info for Psest_2115 in Pseudomonas stutzeri RCH2

Annotation: ATPase components of ABC transporters with duplicated ATPase domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 PF00005: ABC_tran" amino acids 18 to 184 (167 residues), 69.5 bits, see alignment E=1.7e-22 amino acids 335 to 465 (131 residues), 83 bits, see alignment E=1.1e-26 PF12848: ABC_tran_Xtn" amino acids 224 to 301 (78 residues), 76.4 bits, see alignment E=5.4e-25

Best Hits

Swiss-Prot: 75% identical to YBIT_ECO57: Uncharacterized ABC transporter ATP-binding protein YbiT (ybiT) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 95% identity to pfo:Pfl01_2609)

Predicted SEED Role

"ABC transporter ATP-binding protein uup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMU7 at UniProt or InterPro

Protein Sequence (529 amino acids)

>Psest_2115 ATPase components of ABC transporters with duplicated ATPase domains (Pseudomonas stutzeri RCH2)
MISTANITMQFGAKPLFENVSVKFGGGNRYGLIGANGCGKSTFMKILGGDLEPSAGQVML
EPNVRLGKLRQDQFAYEEFNVIDTVIMGHEDLWKVKAERDRIYSLPEMSEEDGMKVGELE
GEFAEMDGYTAESRAGELLLGLGIPLEQHFGPMSEVAPGWKLRVLLAQALFSDPDVLLLD
EPTNHLDINTIRWLETILTARNSTMIIISHDRHFLNSVCTHMADLDYGELRLFPGNYDEY
MTAATQSREQLLSDNAKKKAQIAELQTFVSRFSANASKAKQATSRAKQIDKIQLAEVKPS
SRISPFIRFEQTKKLHRQAVTVERLSKAFDDKELFKNFSFTVEAGERVAIIGPNGIGKTT
LLRTLVGELTPDSGSVKWTESADYGYYAQDHAHDFEDDVSLFDWMGQWTQGGEQLVRGTL
GRMLFSNDEILKSVKVISGGEQGRMLFGKLILQKPNVLVMDEPTNHLDMESIEALNLALE
NYPGTLIFVSHDREFVSSLATRIIELSANGVTDFSGSYDDYLRSQGVIV