Protein Info for Psest_2114 in Pseudomonas stutzeri RCH2

Annotation: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF00561: Abhydrolase_1" amino acids 29 to 298 (270 residues), 123.6 bits, see alignment E=1.6e-39 PF12146: Hydrolase_4" amino acids 30 to 141 (112 residues), 36.2 bits, see alignment E=6.2e-13 PF12697: Abhydrolase_6" amino acids 32 to 307 (276 residues), 67.2 bits, see alignment E=5.2e-22

Best Hits

KEGG orthology group: None (inferred from 67% identity to pfs:PFLU3137)

Predicted SEED Role

"Epoxide hydrolase (EC 3.3.2.9)" (EC 3.3.2.9)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.3.2.9

Use Curated BLAST to search for 3.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIT5 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Psest_2114 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) (Pseudomonas stutzeri RCH2)
MTATADHFQLDLNGISLSLYCFGPEEGRPVWLLHGFPECWHSWRNQIDPLVAAGYRVFVP
EMRGYGNSSAPAEVTAYDVLTLCGDIRAAMDHFGHGQVAVVGHDWGAMVSWYLALLEPER
VAALVTMSVPFAGRPRRPAIEIMRETSAGRFNYILYFQEPGRAERELDVDVDRTLRLLMY
YQGRNLLLQDKPADGTLFEDDMQAGPLPQWCTEEDLSIYRRTFAGHGFRGALNWYRNFER
NWQLTEPLQGQKIVQPTMFLIGNHDPVAELEAYTLKKMPDWVPDLEQRVLAPCGHWIQNE
QAGRVNELLLGFLARRYPG