Protein Info for Psest_2113 in Pseudomonas stutzeri RCH2

Annotation: undecaprenyl-diphosphatase UppP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 44 to 63 (20 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details TIGR00753: undecaprenyl-diphosphatase UppP" amino acids 9 to 256 (248 residues), 261.5 bits, see alignment E=4.7e-82 PF02673: BacA" amino acids 9 to 259 (251 residues), 283.9 bits, see alignment E=7.4e-89

Best Hits

Swiss-Prot: 97% identical to UPPP1_PSEU5: Undecaprenyl-diphosphatase 1 (uppP1) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 97% identity to psa:PST_2210)

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.27

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLJ2 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Psest_2113 undecaprenyl-diphosphatase UppP (Pseudomonas stutzeri RCH2)
MDLWVAIQALILGVVEGITEFLPVSSTGHQIIVADLIGFGGERALAFNIIIQLGAILAVI
WEYRRKIIDVVVGLPKERQAQKFTTNLLIAFLPAVVLGVAFADLIHEYLFNPITVATALV
IGGIVMLWAERRDHAIRAETVDDMTWTLALKVGFAQCLALVPGTSRSGSTIIGGLLFGLS
RKAATEFSFFLAMPTMVGAAVYSGYKYRDLFQPGDFAVFAIGFVTSFIFAMLAVRALLKF
IGNHSYAAFAWYRIGFGLLILATWQLGLIDWTSVQA