Protein Info for PGA1_c21020 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): component of stress sensing system with PGA1_c21010 (DUF692)
Rationale: PFam PF09836.5 (DUF2063). Conserved cofitness and pleiotropic phenotypes
Original annotation: Uncharacterized protein conserved in bacteria (DUF2063).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF09836: DUF2063" amino acids 5 to 95 (91 residues), 79.5 bits, see alignment E=9.4e-27

Best Hits

KEGG orthology group: None (inferred from 68% identity to sil:SPO1279)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EY51 at UniProt or InterPro

Protein Sequence (251 amino acids)

>PGA1_c21020 component of stress sensing system with PGA1_c21010 (DUF692) (Phaeobacter inhibens DSM 17395)
MTVSQTEFTHAMMDAGQPVPEGLLDATGQPAGRRFSVYRNNIAVSLSEAMHSAFPLIGKL
LGEQNLDGLAGMYLRAHPPSSPLMMHYGAEFPAFLARMEQLKHLGYLPDAARLDLALRRA
YHAGDATAVAPARLAALPPEALMATRLTLAPAVALLRSPWPIYDIWRFNTEKNAPKPRHM
AQDVLITRPEFDPIIQELPPGGADWITALTSGATLEEALTAVQANHPDFDLSHTLALLLQ
GGAIIDLDRKG