Protein Info for PGA1_c21010 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): component of stress sensing system, with PGA1_c21020 (DUF2063)
Rationale: PFam PF05114.9 (DUF692). Conserved cofitness and pleiotropic phenotypes
Original annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05114: DUF692
  • amino acids 12 to 277 (266 residues), 343 bits, E=5.4e-107

Best Hits

Swiss-Prot: 59% identical to Y4857_AGRRK: UPF0276 protein Arad_4857 (Arad_4857) from Agrobacterium radiobacter (strain K84 / ATCC BAA-868)

KEGG orthology group: K09930, hypothetical protein (inferred from 83% identity to sil:SPO1280)

Predicted SEED Role

"Uncharacterized protein conserved in bacteria, NMA0228-like"

Sequence Analysis Tools

See I7DRX2 at UniProt or InterPro

Protein Sequence (282 amino acids)

>PGA1_c21010 component of stress sensing system, with PGA1_c21020 (DUF2063) (Phaeobacter inhibens DSM 17395)
MLDAAPFLPAATGVGYKPQHFADILADAGPVKWLEIHAENYMGDGGRPIAQLRHLCEQFA
ISVHGVGLSIGGEGPLDADHLARLKHLVGWLNPASFSEHLAWSTHDSHFYNDLLPLPYTD
ATLARVCDHINQVQDTIGRRMLLENPSSYLAFAESSWSEPEFLTEITRRTGCGLLLDVNN
VFVSATNLDFSPQGYIDAFALDQVGEIHLGGHDEDEDDHGKPLLIDSHGAEVVDPVWALL
DYTLAKSGPKPVLVEWDTDVPDWPVLAAEATRAATALERVSA