Protein Info for HP15_2023 in Marinobacter adhaerens HP15
Annotation: UDP-glucuronic acid epimerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 60% identical to YCL2_ECO11: Uncharacterized 37.6 kDa protein in cld 5'region from Escherichia coli O111:H-
KEGG orthology group: K01795, [EC: 5.1.3.-] (inferred from 93% identity to maq:Maqu_1687)Predicted SEED Role
"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)
MetaCyc Pathways
- UDP-α-D-galactose biosynthesis (1/1 steps found)
- UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
- colanic acid building blocks biosynthesis (8/11 steps found)
- superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
- UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
- UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
- D-galactose detoxification (1/3 steps found)
- D-galactose degradation I (Leloir pathway) (2/5 steps found)
- stachyose degradation (2/7 steps found)
- UDP-sugars interconversion (3/9 steps found)
- teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
- superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
- mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 5.1.3.2
Use Curated BLAST to search for 5.1.3.- or 5.1.3.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E4PQR7 at UniProt or InterPro
Protein Sequence (335 amino acids)
>HP15_2023 UDP-glucuronic acid epimerase (Marinobacter adhaerens HP15) MKILVTGTAGFIGSHLAHRLLDRGDEVIGVDNVNDYYDVNLKEARLKRLTDKAGFTEVRQ DVADRAAMEALFAEHKPERVVHLAAQAGVRYSIENPHAYVDANLVGFMNILEGCRHNKVK HLVYASSSSVYGANETMPFSVHDNVDHPLSLYAASKKANELMAHTYSHLYNLPTTGLRFF TVYGPWGRPDMALFIFTKKILAGEPIDVFNHGHHRRDFTYIDDIVEGVIRTLDHVAEPNG EWSGATPDPGTSKAPYRLYNIGSNNPVELSRFIEIIEERVRKKAQKNLLPLQPGDVPATY ANVDDLIDDVGYKPATPVEEGIARFVDWYRDFYNV