Protein Info for HP15_2023 in Marinobacter adhaerens HP15

Annotation: UDP-glucuronic acid epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 1 to 237 (237 residues), 70.3 bits, E=6e-23
• PF02719: Polysacc_synt_2
  • amino acids 3 to 208 (206 residues), 55.7 bits, E=1.8e-18
• PF01370: Epimerase
  • amino acids 3 to 237 (235 residues), 200.1 bits, E=1.6e-62
• PF08659: KR
  • amino acids 3 to 136 (134 residues), 26.8 bits, E=1.8e-09
• PF16363: GDP_Man_Dehyd
  • amino acids 4 to 324 (321 residues), 178.7 bits, E=8.9e-56
• PF01073: 3Beta_HSD
  • amino acids 4 to 236 (233 residues), 63.5 bits, E=7e-21
• PF13460: NAD_binding_10
  • amino acids 7 to 160 (154 residues), 28.9 bits, E=4.1e-10

Best Hits

Swiss-Prot: 60% identical to YCL2_ECO11: Uncharacterized 37.6 kDa protein in cld 5'region from Escherichia coli O111:H-

KEGG orthology group: K01795, [EC: 5.1.3.-] (inferred from 93% identity to maq:Maqu_1687)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• colanic acid building blocks biosynthesis (8/11 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.- or 5.1.3.2

Sequence Analysis Tools

See E4PQR7 at UniProt or InterPro

Protein Sequence (335 amino acids)

>HP15_2023 UDP-glucuronic acid epimerase (Marinobacter adhaerens HP15)
MKILVTGTAGFIGSHLAHRLLDRGDEVIGVDNVNDYYDVNLKEARLKRLTDKAGFTEVRQ
DVADRAAMEALFAEHKPERVVHLAAQAGVRYSIENPHAYVDANLVGFMNILEGCRHNKVK
HLVYASSSSVYGANETMPFSVHDNVDHPLSLYAASKKANELMAHTYSHLYNLPTTGLRFF
TVYGPWGRPDMALFIFTKKILAGEPIDVFNHGHHRRDFTYIDDIVEGVIRTLDHVAEPNG
EWSGATPDPGTSKAPYRLYNIGSNNPVELSRFIEIIEERVRKKAQKNLLPLQPGDVPATY
ANVDDLIDDVGYKPATPVEEGIARFVDWYRDFYNV