Protein Info for Psest_2105 in Pseudomonas stutzeri RCH2

Annotation: Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 150 to 166 (17 residues), see Phobius details amino acids 236 to 252 (17 residues), see Phobius details PF00072: Response_reg" amino acids 7 to 116 (110 residues), 83.1 bits, see alignment E=8e-28

Best Hits

KEGG orthology group: None (inferred from 92% identity to psa:PST_2219)

Predicted SEED Role

"Chemotaxis protein CheC -- inhibitor of MCP methylation" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMT7 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Psest_2105 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain (Pseudomonas stutzeri RCH2)
MSAISLLICDDSSLARKQLLHALPAGWPVTVSQAATGVEALDRIRQGDIDVLLLDLTMPE
MDGYQVLAQLREEQLECKTIVISADIQEEAVRRVLALGARAFIKKPADPVHLRQTLASLG
LLDDVSALITRVDGERISFRDTFREVVNIAMGRAAALLARVLGVFIQLPIPNVNILEVGE
LHMALADAARGEKLTAVCQGYIGGGIAGEALLLFHDSEVADMARLMRRQDYLEMEMLLDL
SSLLISACLSGIAEQIEVVFSQGHPQVLGQHASIEELIRINSGRWKKTLAVEISYSLEGH
DIHFDLLLLFTEDSVELLTRKLAHLMD