Protein Info for HP15_2016 in Marinobacter adhaerens HP15

Annotation: inner-membrane translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 46 to 68 (23 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 210 to 234 (25 residues), see Phobius details amino acids 246 to 269 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 4 to 258 (255 residues), 98.4 bits, see alignment E=2.1e-32

Best Hits

KEGG orthology group: None (inferred from 47% identity to rle:pRL100129)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQR0 at UniProt or InterPro

Protein Sequence (282 amino acids)

>HP15_2016 inner-membrane translocator (Marinobacter adhaerens HP15)
MGKGLVVLGLVLLMRAGLVSFGQGLYYCVGAYVAGMLTQFVGVTDILVIMLASVAVSVAI
AAIIGLLLCRYREIFFAMFSMAFSMILYGLLVRNQFLGSTDGFNVANPSLLGWTPGAEAS
SDLVLIVAVFLVIVLGAVAWRYLKSLSGYAGEAVRENEIRLEYLGGSVFRVVYVKYIIAA
ALAAIGGTITALVSGHVDPEMAYWTTSGEFVFIALMGGTAHVAAPIVAAVLFEALRTYAF
AVSPYTWQMILGFALLAIILFMPSGLWSLVERFQNKKARKTS