Protein Info for PGA1_c02100 in Phaeobacter inhibens DSM 17395

Annotation: diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 72 to 231 (160 residues), 60.1 bits, see alignment E=1.1e-20 PF00990: GGDEF" amino acids 72 to 227 (156 residues), 87.1 bits, see alignment E=1.1e-28 PF00563: EAL" amino acids 251 to 486 (236 residues), 214.1 bits, see alignment E=1.9e-67

Best Hits

KEGG orthology group: None (inferred from 65% identity to sil:SPO0533)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EIK1 at UniProt or InterPro

Protein Sequence (514 amino acids)

>PGA1_c02100 diguanylate cyclase (GGDEF) domain-containing protein (Phaeobacter inhibens DSM 17395)
MTKTLSQTLTQVRKRIAPVLLGPPLLAFLPAMTLATFWLAGEAALLAVALGLPLIFAASG
GIAYFRRPTMPRDSLTGMMMRDGFKEIVSEVYDSAADTGLRSAVFIVELDDFKELAQRHG
QETADQLVNRCGDRIISILRPQDYVARIGDSRFAICLTPVLQMDLELAIQMAGRLQASIE
EPIAVDGASLYVSCSIGFCLHSRTPRPSGNDWMSAACTALLDAQNNGPSGIRAFSPEMDQ
RSKARGDMLDEVTEALENGQIQAWFQPQICTDTGRVSGFEALARWAHPVRGMIAPMSFLP
TLESAGLMERLSEIMLYNALTALKAWDAAGLNVPSVGVNFATDELRNANLVERITWELER
FGLTPDRLSIEILETVMTDRPDDMIVRNIAALGELGCGIDLDDFGTGHASIAAVQRFRVS
RIKIDRSFVMKADRDPEQQKLIAAILTMAERLDLATLAEGVETVGEHALLSQLGCDHVQG
FGIGRPMPFDQTLDWIAAHEAKLQEAPTIGRQGN