Protein Info for HP15_2015 in Marinobacter adhaerens HP15

Annotation: inner-membrane translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 42 to 59 (18 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 188 to 213 (26 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 282 (275 residues), 116.5 bits, see alignment E=6.2e-38

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 56% identity to mdi:p1METDI0065)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQQ9 at UniProt or InterPro

Protein Sequence (298 amino acids)

>HP15_2015 inner-membrane translocator (Marinobacter adhaerens HP15)
MKQLLAILVDGSVYASWLFIISAGLTLIYGVMRILNMSHGSFYALGAYSGAAMVGWYFST
GSVPWFSFVALIAAALVAGISVGLLVERGLLRFMYGRDEVVMILVTYGVLLIMEDAIKLI
WGVEPYFAYQPYTLLGRTKFAGLSFANYDFMLIGVSILIGLALWYGLNRTRNGKLLRVVI
HDREIASALGINVARIFTITFLIGAGIGSLAGALTAPGLSVVPGMGIEVIVLAFAVVVIG
GLGSITGALVGALIVGMSRAAAVHLYPDVELFVIYAVMGLVLAFRPQGLFAVANARKI