Protein Info for HP15_2011 in Marinobacter adhaerens HP15

Annotation: two component, sigma54 specific, transcriptional regulator, Fis family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF00072: Response_reg" amino acids 6 to 115 (110 residues), 96.6 bits, see alignment E=3.5e-31 PF13191: AAA_16" amino acids 141 to 233 (93 residues), 33.1 bits, see alignment E=2.8e-11 PF00158: Sigma54_activat" amino acids 141 to 307 (167 residues), 213.9 bits, see alignment E=4.1e-67 PF14532: Sigma54_activ_2" amino acids 142 to 312 (171 residues), 65.1 bits, see alignment E=2.9e-21 PF07728: AAA_5" amino acids 166 to 284 (119 residues), 38.3 bits, see alignment E=4.7e-13 PF00004: AAA" amino acids 166 to 283 (118 residues), 30.8 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 41% identical to NTRC_SALTY: DNA-binding transcriptional regulator NtrC (glnG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 53% identity to mmw:Mmwyl1_4419)

Predicted SEED Role

"Acetoacetate metabolism regulatory protein AtoC" in subsystem Acetyl-CoA fermentation to Butyrate or Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQQ5 at UniProt or InterPro

Protein Sequence (392 amino acids)

>HP15_2011 two component, sigma54 specific, transcriptional regulator, Fis family (Marinobacter adhaerens HP15)
MRTPTVLIIDDEKNLVSSLMFSLEEEGMTVFAAYDGKSGLTEIEKRTPDVVLLDLKLPDQ
SGFEVLDQVQALPAPPITIMISAHGDTRAAVEAVKKGAQDYITKPFDLDELILLIQRNHK
HRQLTEEVAYRREREADVHGLVGHSSAMRKLLDQVERIGKSSARTVLLQGPSGSGKTLIA
KALHATKDRAAPFVSVNCASLPENLLEAELFGAEKGAYTGADKRRTGLVELANGGTLFLD
EIGELPLPLQAKLLTFLETHRFRAVGGQKEIEADLRVIAASNRDLQTEAQTGAFREDLFY
RLNVMPLTIPSLAERRDDIPMLASNFATGLAAQEGCRPINLSSETLTTLCNYDWPGNIRE
LRNTIERLTILHAGESINVDQLPPEITKSAPQ