Protein Info for HP15_2010 in Marinobacter adhaerens HP15

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 614 transmembrane" amino acids 62 to 81 (20 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details PF00672: HAMP" amino acids 340 to 379 (40 residues), 30.8 bits, see alignment 4.4e-11 PF00512: HisKA" amino acids 394 to 456 (63 residues), 53.2 bits, see alignment E=3.9e-18 PF02518: HATPase_c" amino acids 500 to 604 (105 residues), 84.9 bits, see alignment E=8e-28

Best Hits

Predicted SEED Role

"sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQQ4 at UniProt or InterPro

Protein Sequence (614 amino acids)

>HP15_2010 sensor histidine kinase (Marinobacter adhaerens HP15)
MPVHSETFPGRLSQNQNEAPPRNIPRPRNSRYDLCMKSIIKHDASAPPRLRVLRRNGLAR
RYLFSALLIALIPLVVLAFMYDTQYVKALEKVTESRTNARLAGAENLLRTFLQERIYELE
ALADVPEVFDWLTTANAEEKPNAEVMAQLRQALDSPHLYGVVVKPSRYEAPLWYLTQTLL
QQVELDELPLTPFANGEIIGPALPTDSRPGWFVLRLSPTGLNPAPEAWVGLVVRLASLTD
QVKDLSLTGLQSPLIVTPQNVPITAVGNIPGQPSYSAKDINSNDFIEGWHIRLQWLGDPL
LGPLESARFGLILLASGAALAVILLSRHLSKRLEKQVTPLIEGADRVAGGDFDTPLHTEG
TAEIGYLAFALERMRLRLRRLVKSMVDVERRAILGQFSAGVAHEIRNPLATIKTTIQALS
RKESDPKRQKLMESVDHEIDRVNDVVQLLLDYARPREAKASKVNIIDVVETVKILADAVA
HRHGIELVQVEHESVYAWADSSQVRQIVMNLVMNAIQAMEGIGGRVTIRTKQQGLAVYVS
VSDNGPGVSADHLIHLTEPFFTTKTNGTGLGLAICRQLAQANQGNLRFQSVSGEGLKVTL
KLPLYLNNENQGSV