Protein Info for Psest_2093 in Pseudomonas stutzeri RCH2

Annotation: Leucine Rich Repeat./Protein kinase domain.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 PF00560: LRR_1" amino acids 38 to 58 (21 residues), 13.7 bits, see alignment (E = 1.9e-05) PF13855: LRR_8" amino acids 104 to 162 (59 residues), 32 bits, see alignment E=3e-11 PF07714: PK_Tyr_Ser-Thr" amino acids 208 to 373 (166 residues), 52.9 bits, see alignment E=1.2e-17 PF00069: Pkinase" amino acids 209 to 374 (166 residues), 50.9 bits, see alignment E=5.1e-17 PF06293: Kdo" amino acids 319 to 360 (42 residues), 22.8 bits, see alignment 2e-08

Best Hits

KEGG orthology group: None (inferred from 78% identity to psa:PST_2232)

Predicted SEED Role

"serine/threonine protein kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLH3 at UniProt or InterPro

Protein Sequence (438 amino acids)

>Psest_2093 Leucine Rich Repeat./Protein kinase domain. (Pseudomonas stutzeri RCH2)
MHTLEQLERGELAGIRRLDLSAGLQSFPEAIFDLADTLEVLNLSGNQLKSLPSDLSRLRK
LRILFCSDNLFTEVPDCLGDCEQLEMIGFKANQIRHLPAAALPPALRWLILTDNQLQALP
DEIDTCRRLQKLMLAGNQLSSLPDTLANCVNLELLRIAANRLPALPAWLLTLPRLSWLAA
AGNSFSDANEAISLARHSLPAIPREQVVLHEQLGQGASGIIYRAEWQQSGQPPKQMAAKQ
FKGHVTSDGLPHSEMAACVAAGAHPNLIDVAGPLADQSGQTPGLLMDLVEPAFQPLAGPP
SLASCTRDCYADDLTFSLDQALRIARGAASAVAHLHQRGILHGDLYAHNLLVNAQGTCLL
SDFGAASFFEPESTTGRALQRIESRAFGCLLEELLQRCPGFDGDRRRGTLLELQNQCLSE
QPEHRPHFHQLATTLAAL