Protein Info for PGA1_c20740 in Phaeobacter inhibens DSM 17395

Annotation: uroporphyrinogen-III C-methyltransferase CobA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 TIGR01469: uroporphyrinogen-III C-methyltransferase" amino acids 30 to 259 (230 residues), 244.2 bits, see alignment E=8.1e-77 PF00590: TP_methylase" amino acids 32 to 241 (210 residues), 160 bits, see alignment E=4.1e-51

Best Hits

KEGG orthology group: K02303, uroporphyrin-III C-methyltransferase [EC: 2.1.1.107] (inferred from 79% identity to sit:TM1040_1756)

MetaCyc: 44% identical to CobA (Pseudomonas denitrificans (nom. rej.))
Uroporphyrinogen-III C-methyltransferase. [EC: 2.1.1.107]; 2.1.1.107 [EC: 2.1.1.107]

Predicted SEED Role

"Uroporphyrinogen-III methyltransferase (EC 2.1.1.107)" in subsystem Coenzyme B12 biosynthesis or Dissimilatory nitrite reductase or Experimental tye or Heme and Siroheme Biosynthesis (EC 2.1.1.107)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.107

Use Curated BLAST to search for 2.1.1.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E227 at UniProt or InterPro

Protein Sequence (277 amino acids)

>PGA1_c20740 uroporphyrinogen-III C-methyltransferase CobA (Phaeobacter inhibens DSM 17395)
MTGPDTIPPRARLPMQGVACVSVSSSLVAGEVAFAGSGPGDPDLLTLKVARALLQADVIL
FDRLVSAEIMALARPQAQLEDVGKEGFGPQVSQEEICVRMVAHARAGKKVLRLKSGDPTV
YGRLDEELTACEAAGVAYQILPGITAASAAVASIGQSLTQRGRNASVRFLTGHDMKGFAD
HDWAALARPGEVAAIYMGKKSARFVQGRLIMHGADRATPMTIVENASRANQRVIETTLER
LPTDLAAAELTGPALTFLGLAPRASAQALTNLKLELA