Protein Info for PGA1_c20700 in Phaeobacter inhibens DSM 17395

Annotation: C4-dicarboxylate transport sensor protein DctB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 280 to 302 (23 residues), see Phobius details PF00512: HisKA" amino acids 363 to 430 (68 residues), 46.1 bits, see alignment E=4.2e-16 PF02518: HATPase_c" amino acids 474 to 583 (110 residues), 62.8 bits, see alignment E=3.9e-21

Best Hits

KEGG orthology group: K10125, two-component system, NtrC family, C4-dicarboxylate transport sensor histidine kinase DctB [EC: 2.7.13.3] (inferred from 68% identity to sil:SPO2630)

Predicted SEED Role

"C4-dicarboxylate transport sensor protein (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F0K1 at UniProt or InterPro

Protein Sequence (599 amino acids)

>PGA1_c20700 C4-dicarboxylate transport sensor protein DctB (Phaeobacter inhibens DSM 17395)
MRPMTQFHAHRWIILALLLGAVAAVAGGVYRLGYRQALDSLAERSAADLALASDRVTTQL
QVYQELAVLMADHPTLKRLDRAEARVAAQGLLREVADKTAALDVFFVDRAGRVVVAAEGV
MGRDVTQTGYFHRAMQGALGTGYGVLQPDGRRAYIYAAPDFDVDGRVRGALVVVADVEDV
EQTWRGSLPAVFFTNRGGEVFIANRRELLFWQRSAEGPGLSPPDGRQVALRSWLEGPHEI
WDLRWSPYLPERALHQAVNLPQIGMVGEILVDVAPARRLAGLQAAAMAAIVLALGAMLVL
AIERRRTLAEANTVLESRVAARTRALSATNMRLTREVQERQEAEAALKRAQQDLVQAGKL
SALGQMSAGISHELNQPLMAIQQYAENGEAFVARGKPERAGENLGRIAQMAGRMARIIKN
LRAFARNESEPMGRVDLGQVIASAIELTEPRLRQDGAHLHWQPPAEPVFAWGGEVRLSQV
FVNLINNAADAMLEQEQREIRIAIETRHDEGDARLAVIVRDIGPGLKEPEKIFDPFYSTK
AVGSSEGMGLGLSISYGLVQSFGGHIRGVNTGDGAEFTVELDRWRAQADTDTQQQDEVA