Protein Info for HP15_1993 in Marinobacter adhaerens HP15

Annotation: exonuclease RNase T and DNA polymerase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 PF00929: RNase_T" amino acids 20 to 177 (158 residues), 77 bits, see alignment E=1.3e-25

Best Hits

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 47% identity to tmz:Tmz1t_2342)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQN7 at UniProt or InterPro

Protein Sequence (190 amino acids)

>HP15_1993 exonuclease RNase T and DNA polymerase III (Marinobacter adhaerens HP15)
MDLKQHAAELARFWLHDNAVIIDTETTGLTDTDEIVEISVINCHGTTLLDTLIRPSSEIN
PAAQAVHGITLAETADAPTFDQVLPDLLRVIQGKTVVMYNSSYDARLIQQSAMKRGCRAP
TLYPHCAMKTYAKFYGQWDDYRESWKWQSLDKAARQCGVTVDGNAHRALTDCFTTLGVIK
AMAAYNPAVA