Protein Info for Psest_2078 in Pseudomonas stutzeri RCH2

Annotation: NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF09296: NUDIX-like" amino acids 16 to 105 (90 residues), 50.8 bits, see alignment E=3.7e-17 PF09297: Zn_ribbon_NUD" amino acids 108 to 138 (31 residues), 42.3 bits, see alignment 7.4e-15 PF00293: NUDIX" amino acids 143 to 256 (114 residues), 79.3 bits, see alignment E=4.3e-26

Best Hits

Swiss-Prot: 93% identical to NUDC_PSEU5: NADH pyrophosphatase (nudC) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K03426, NAD+ diphosphatase [EC: 3.6.1.22] (inferred from 93% identity to psa:PST_2247)

Predicted SEED Role

"NADH pyrophosphatase (EC 3.6.1.22)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLF7 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Psest_2078 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding (Pseudomonas stutzeri RCH2)
MSLRWQAALLDPTLPGGWVVVHCRQQFLLDDNGALFPRDWLKRLELPVLSEQGLGHFDGQ
PVFLFELEFPADVPGARWQGLRQFMQGDDRDLFQLLGYATQIGTWASQHRFCGSCGSPMQ
ARAGERAMYCPACGVQHYPRLSPSMIVLVTRGDELLLARSPRFAPGVYSTLAGYVEPGES
VEQCVAREVREEVGVSIHPPQYVASQGWPFPHSLMLGFHAEYAGGEIVPQPEEIEDARWF
PIDNLPALPARQSIARYLIELYLARRLGRPDPVLPG