Protein Info for PGA1_c02070 in Phaeobacter inhibens DSM 17395

Annotation: putative GTP binding protein EngB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 TIGR03598: ribosome biogenesis GTP-binding protein YsxC" amino acids 28 to 212 (185 residues), 218.1 bits, see alignment E=3.9e-69 PF01926: MMR_HSR1" amino acids 46 to 163 (118 residues), 70.6 bits, see alignment E=2.4e-23 PF02421: FeoB_N" amino acids 46 to 209 (164 residues), 35.2 bits, see alignment E=1.7e-12

Best Hits

Swiss-Prot: 87% identical to ENGB_RUEST: Probable GTP-binding protein EngB (engB) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K03978, GTP-binding protein (inferred from 87% identity to sit:TM1040_0305)

Predicted SEED Role

"GTP-binding protein EngB" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVX1 at UniProt or InterPro

Protein Sequence (216 amino acids)

>PGA1_c02070 putative GTP binding protein EngB (Phaeobacter inhibens DSM 17395)
MQMPFPLAETPDEIMTEKGRKLFAGQSEFVKGVVAMSGLPPADRIEVCFAGRSNVGKSSL
INALTGTKGLARASNTPGRTQEINYFTQGPELYLVDLPGYGYANAPLPIVEKWQRLLKQY
LSGRQTLRRSFVLIDSRHGIKKVDDEIMTRLDSSAVTFQCVMTKADKVKDKDRAVVMEQV
RSALSKHPAAYPEIVMTSSEKGDGIATLRSIIAGLE