Protein Info for HP15_202 in Marinobacter adhaerens HP15

Annotation: oligopeptide/dipeptide ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 99 to 124 (26 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 223 to 248 (26 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details PF12911: OppC_N" amino acids 17 to 67 (51 residues), 49.7 bits, see alignment 2.7e-17 PF00528: BPD_transp_1" amino acids 114 to 307 (194 residues), 107.5 bits, see alignment E=7.2e-35

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 97% identity to maq:Maqu_0451)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PK35 at UniProt or InterPro

Protein Sequence (310 amino acids)

>HP15_202 oligopeptide/dipeptide ABC transporter, permease protein (Marinobacter adhaerens HP15)
MTTATVSRWDRFRESFFWYSFKRDKVAIVSFAVLLLMVLAAVFAPLLAPADPYDLAQINI
MNSELPPVGMSGADPAFPLGTDAQGRDLLSTILYGTRVSLMIGFGAVVLQAFLGILFGLL
AGYLGGKVDAVLMRIADVQLSFSTLMVAIIVGAVFKASFGNLMFGEIAIYMLIFIIGVAE
WPQIARTVRASVLAEKKKEYVDAAKVMGFGTRRIMFRHILPNTLSPIFVIATVQIANAII
SEAALSFLGLGMPETQPSLGSLIKSGFDYIQSGSWWITLIPGLVLVVLVLVINLLGDWLR
DVMNPRLYKG