Protein Info for Psest_2071 in Pseudomonas stutzeri RCH2

Annotation: hydroxyacylglutathione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR03413: hydroxyacylglutathione hydrolase" amino acids 4 to 259 (256 residues), 343.7 bits, see alignment E=2.7e-107 PF00753: Lactamase_B" amino acids 42 to 171 (130 residues), 56.8 bits, see alignment E=3.1e-19 PF16123: HAGH_C" amino acids 172 to 259 (88 residues), 92.5 bits, see alignment E=1.7e-30

Best Hits

Swiss-Prot: 66% identical to GLO2_PSEF5: Hydroxyacylglutathione hydrolase (gloB) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K01069, hydroxyacylglutathione hydrolase [EC: 3.1.2.6] (inferred from 81% identity to psa:PST_2254)

MetaCyc: 48% identical to hydroxyacylglutathione hydrolase GloB (Escherichia coli K-12 substr. MG1655)
Hydroxyacylglutathione hydrolase. [EC: 3.1.2.6]

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMJ6 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Psest_2071 hydroxyacylglutathione hydrolase (Pseudomonas stutzeri RCH2)
MLKIEALPAFTDNYIWLLQDDATQRCAAVDPGDAAPVLSWLQDHLDWRLSDILITHHHHD
HVGGVERLKTQTGARVYGPAAENIPARDEALSDGQRIRVLDKDLEVIAVPGHTLGHIAYV
HSDAEQPWLLSGDTLFAAGCGRLFEGTPEQMFASLQRLASLPDDTLVYCTHEYTLSNLRF
AQAVEPYNQEIQQRVREVTALREENHFSLPTRMNIERATNPFLRSSVEAVQQAASEHCGR
RLEDEVAVFAALRAWKDRF