Protein Info for Psest_2070 in Pseudomonas stutzeri RCH2

Annotation: FOG: LysM repeat

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 PF01464: SLT" amino acids 89 to 189 (101 residues), 91.2 bits, see alignment E=8.8e-30 PF01476: LysM" amino acids 310 to 352 (43 residues), 49.3 bits, see alignment 9.4e-17 amino acids 378 to 418 (41 residues), 48.2 bits, see alignment 2.1e-16 amino acids 437 to 477 (41 residues), 35.3 bits, see alignment 2.2e-12

Best Hits

KEGG orthology group: K08307, membrane-bound lytic murein transglycosylase D [EC: 3.2.1.-] (inferred from 91% identity to psa:PST_2255)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase D precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMQ4 at UniProt or InterPro

Protein Sequence (482 amino acids)

>Psest_2070 FOG: LysM repeat (Pseudomonas stutzeri RCH2)
MRDETREQTRRATTPVAQEPIWLNDTTAITEHEDIWERIREGYKLQEHLDSNPRIEQQRL
LLSSRPKSIEVVSERSSPFIHYIVERLEERDMPLELALLPIIESSYDPFAYSPAHAVGLW
QFIPSTGRHFNLRQTSWYDGRRDITASTNAALRYLSYLHGLFNGDWLLALAAYNAGEGTV
SRAIERNQKLGLPTDYWNLPLPRETRDYVPKLLALSQLIQAPEAYGINLNPIANEPYFEV
IALKQRMDLARVAKLADLDEDELYQLNPAFTRRITLDGPQQLLVPMEKAEMLAANLALMK
PQDLVDWQQYQVRAGDTLGVIANRHHLTVNIIRDVNRLKSDTLRVGQVLSLPTSSDAKAS
RELLHAVARQPASTPRTYRVKTGDNLWDIAKAQRVSVRDLQRWNRLSGSQLKVGQALFLQ
GPATRTPAKKDNSPTYYKVQKGDSLYQIAKRFNVQLTNLKTWNPKGTEVLRPGQLLTLYL
PN