Protein Info for Psest_0203 in Pseudomonas stutzeri RCH2

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details transmembrane" amino acids 175 to 197 (23 residues), see Phobius details PF08521: 2CSK_N" amino acids 22 to 170 (149 residues), 148.4 bits, see alignment E=2.9e-47 PF00672: HAMP" amino acids 195 to 242 (48 residues), 28.5 bits, see alignment 3.1e-10 PF00512: HisKA" amino acids 248 to 312 (65 residues), 48 bits, see alignment E=2.1e-16 PF02518: HATPase_c" amino acids 361 to 460 (100 residues), 75.3 bits, see alignment E=1.1e-24

Best Hits

KEGG orthology group: K07649, two-component system, OmpR family, sensor histidine kinase TctE [EC: 2.7.13.3] (inferred from 96% identity to psa:PST_4043)

Predicted SEED Role

"Tricarboxylate transport sensor protein TctE"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHM1 at UniProt or InterPro

Protein Sequence (466 amino acids)

>Psest_0203 Signal transduction histidine kinase (Pseudomonas stutzeri RCH2)
MAEPEVAGSLRARLLRRLAVLLALLLLFSGWSAYWNGRAAADTAYDRTLLASARAIADGL
VANDGKLRANVPYVALDTFAYDSAGRIYYQVLDIEGRLVSGYEDLPAPRADTPRTDDYPA
LARFYDGQFQGQGVRLVSLLQPVSEPELNGIAEIRVAETLGARERMARSLLTDTLWRVGL
LAIAALVLVWLAVSAALRPLGRLSEAVQERAPDDLRPLPLVSVQRELRPLVVALNGFTER
LRGQFERQARFIADASHELRTPLAALKARIELGLREADPLAWRSTLDDAGQSTDKVIHLA
NQLLSLARIESGAQSIAEGGAQRLDLSQLARELGLAMAALAHKRGVALALEAEAPVWIDG
EPTLISELLSNLLDNALAHTLNGGNVVLRVLEGAVLEVEDDGPGIPVAEHDRVFARFYRR
DTGGHGAGLGLAIVGEIVRAHRAQISLDQGALGGLLVRVRFIPAEG