Protein Info for Psest_2058 in Pseudomonas stutzeri RCH2

Annotation: Zn-dependent hydrolases, including glyoxylases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR04558: quinoprotein relay system zinc metallohydrolase 1" amino acids 20 to 304 (285 residues), 419.4 bits, see alignment E=3.1e-130 PF00753: Lactamase_B" amino acids 48 to 232 (185 residues), 88.4 bits, see alignment E=6.5e-29 PF12706: Lactamase_B_2" amino acids 64 to 225 (162 residues), 31.2 bits, see alignment E=1.7e-11

Best Hits

KEGG orthology group: None (inferred from 87% identity to psa:PST_2267)

Predicted SEED Role

"SoxH protein, homolog" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLD6 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Psest_2058 Zn-dependent hydrolases, including glyoxylases (Pseudomonas stutzeri RCH2)
MRLFMLIFAFCMTLPVQAELSYTLQPRQIADGVWLLEGSTDNFDKRNGGNIVNTGFIVGD
AGVIVIDTGPSRLYGEAMRAAISRVTDLPVTKVLLTHHHPDHVLGNQAFADVPIAALAGT
TELLREQGNAMAENMYRLVGDWMRGTEVVLPSETVESGTLEVAGRSLRLLALRGHTGADL
AILDERSGVLFAGDILFFQRALTTPNSPGLDVWLDDLTTLEALPWKRLVAGHGPVADDAE
PFRQMRDYLGWLDGLLRDAASSGADMNEVIQSPIPERFAGISLTRFELIRSVSHLYPRYE
VDALQRVDQ