Protein Info for PGA1_c20490 in Phaeobacter inhibens DSM 17395

Annotation: transcriptional regulator, AsnC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF13412: HTH_24" amino acids 1 to 47 (47 residues), 70.4 bits, see alignment E=1.1e-23 PF13404: HTH_AsnC-type" amino acids 1 to 42 (42 residues), 68.3 bits, see alignment E=6.2e-23 PF01037: AsnC_trans_reg" amino acids 64 to 146 (83 residues), 91.6 bits, see alignment E=3.4e-30

Best Hits

Swiss-Prot: 43% identical to BKDR_PSEAE: Bkd operon transcriptional regulator (bkdR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 64% identity to sil:SPO0389)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EN94 at UniProt or InterPro

Protein Sequence (151 amino acids)

>PGA1_c20490 transcriptional regulator, AsnC family (Phaeobacter inhibens DSM 17395)
MDTIDRKILAALQENGRMKIAELAEKVGLSATPCARRVANLEESGVISGYSARVDQTEVG
LPVTIFVAVELERQSTEGLQAFEAAVRRFDQVMECYLMTGSRDILLRVVAQDLTDFDQFL
EHRLMRVPGIRNTRSSFTLRTMICRNVLPLD