Protein Info for Psest_2049 in Pseudomonas stutzeri RCH2

Annotation: Outer membrane receptor proteins, mostly Fe transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 766 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF07715: Plug" amino acids 54 to 167 (114 residues), 51.8 bits, see alignment E=1.1e-17 PF00593: TonB_dep_Rec" amino acids 230 to 711 (482 residues), 163.8 bits, see alignment E=1.3e-51

Best Hits

KEGG orthology group: None (inferred from 87% identity to psa:PST_2276)

Predicted SEED Role

"Outer membrane receptor proteins, mostly Fe transport" in subsystem Hemin transport system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIM7 at UniProt or InterPro

Protein Sequence (766 amino acids)

>Psest_2049 Outer membrane receptor proteins, mostly Fe transport (Pseudomonas stutzeri RCH2)
MPYPLCCSAMPRRTLLSLAIAALLPASVHAAQRLDLGSQEVIGTTPLPGIELPKEQVPSN
IQSLDDEDLRRLGGQSLAEKLQRGLPSVNINEIQGNPYQADLNYRGFTASPLLGTPQGLS
VFLDGVRVNEAFGDVVHWDLIPNTAIANMALVPGSNPLYGLNTLGGALALQTKRGDTHPG
GSAEIYGGSFGRQGGAIEQGGSHEEFSWYLAAEGMDEDGWRDHSPSEVRQLFGKFAWTTD
STDLALTLAHADNDLIGNGLIPESMYDQRRESIFTYPDQTENRSHLMALSASHWLNDNDR
LFATVYLRRTRTATLNGDGNDEYEDEYEAWEDGGFIGEGPESGVLNRTRTAQRAYGLALQ
WARHVGAHQFAFGLSHDNTRASFHQSEQGGELTDSRGIAASEAEEQANSLLGRTRTSSLY
ATDTWALTDALQLTGSLRYNRTRVVNTDRMGDALNGDFTYRKLNPALGFAWQLQPALTVY
GGFSQGNRAPTPIELGCADPANPCSLPNAMAADPFLEQVVTRTLEFGVRGELAGGTRWNL
GAFRSVNHDDLLFVGTGGSMGYFTNFGRTRRQGIEMGLAGEQGPVDWRVDYTFLHATFRS
GACILAENNSTEGEGGCPDDEIRVSSGDYLPGLPKHNLKLGLNWNINERLRVGTSVLAYS
SQYVRGNENNRHQPNDEVEGSGKLPGYAVVNLTADYRLARDWTLFGRVDNLFDKRYATGG
ALAENPFVGTGNAFESDPDEWRHEQFIAPGAPRAGWLGVRYRWDAL