Protein Info for PGA1_c20340 in Phaeobacter inhibens DSM 17395

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 157 to 179 (23 residues), see Phobius details PF13413: HTH_25" amino acids 33 to 91 (59 residues), 57.9 bits, see alignment E=7.5e-20 PF13464: RodZ_C" amino acids 291 to 359 (69 residues), 42.1 bits, see alignment E=6.7e-15

Best Hits

KEGG orthology group: None (inferred from 68% identity to sit:TM1040_0861)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EN84 at UniProt or InterPro

Protein Sequence (407 amino acids)

>PGA1_c20340 Uncharacterized protein conserved in bacteria (Phaeobacter inhibens DSM 17395)
MIGRLTQRKSKTHDESTGPRSFDDYELRLGDIMRGERATMGKSLLDVQRELRIKASYIAA
IENSDPTVFDTPGFIAGYVRSYARYLNMNPDTTFDSFCQESGFQVAHGMSAEASVRKSAG
APIATGMGGLRSDAFTSPNTPFVPAASGVFSQIELRAVGSLAVLVALIGGIGYGGWAVLK
EVQQVQMAPVEQTPIVLADLDPLAGASRDAEVQNEDPALEALDRLYRPQALDVPVLVPRD
GPIATLDPRGFGNFAMPELPSVVLADASLSAEAPLPAMPQVVEETAPALQMVAVRPSWVQ
VTAVDGSVIFETIMEPGQHFEIPATEEAPLLRTGESGAIYFAVNGAHYGPVGDRGQVTKN
VVLSSDALTERFALADLSEDRNSALATLVAELQASSLPVDPVETISE