Protein Info for PGA1_c20330 in Phaeobacter inhibens DSM 17395

Annotation: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase IspG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 TIGR00612: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase" amino acids 14 to 358 (345 residues), 460.4 bits, see alignment E=2.1e-142 PF04551: GcpE" amino acids 18 to 360 (343 residues), 478 bits, see alignment E=8e-148

Best Hits

Swiss-Prot: 93% identical to ISPG_RUEST: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) (ispG) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K03526, (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [EC: 1.17.7.1] (inferred from 93% identity to sit:TM1040_0862)

MetaCyc: 60% identical to (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin) (Escherichia coli K-12 substr. MG1655)
RXN-15878 [EC: 1.17.7.3]

Predicted SEED Role

"1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase (EC 1.17.7.1)" in subsystem Isoprenoid Biosynthesis (EC 1.17.7.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.7.1 or 1.17.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EXZ1 at UniProt or InterPro

Protein Sequence (373 amino acids)

>PGA1_c20330 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase IspG (Phaeobacter inhibens DSM 17395)
MSINHIRPWRHIERRKSRQIHVGNVPVGGDAPIAVQTMTNTPTTDVAATVAQVQAAAEAG
ADIVRVSVPDEASSKALKEIVRESPVPIVADIHFHYKRGIEAAEAGAACLRINPGNIGDE
KRVAEVIRAAKDHNCSIRIGVNAGSLEKHLLDKYGEPCPEAMVESGLDHIRILQDHDFHE
FKISVKASDVFMSAAAYQQLAEATDAPIHLGITEAGGFVSGTIKSAIGLGQLLWMGIGDT
LRVSLSADPVEEVKVGFEILKSLGLRHRGVNIISCPSCARQGFDVIKTVEALEKRLEHVK
TPMSLSIIGCVVNGPGEALMTDVGFTGGGAGSGMVYLAGKASHKMSNAQMVDHIVEEVEK
KAAQLDAEAAAAE