Protein Info for Psest_2040 in Pseudomonas stutzeri RCH2

Annotation: alcohol ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 109 to 134 (26 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 229 to 252 (24 residues), see Phobius details TIGR03861: alcohol ABC transporter, permease protein" amino acids 5 to 257 (253 residues), 463.7 bits, see alignment E=8.6e-144 PF01061: ABC2_membrane" amino acids 11 to 226 (216 residues), 119 bits, see alignment E=3.3e-38 PF12698: ABC2_membrane_3" amino acids 55 to 249 (195 residues), 65.3 bits, see alignment E=8.5e-22 PF12679: ABC2_membrane_2" amino acids 85 to 253 (169 residues), 34.1 bits, see alignment E=2.8e-12

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 94% identity to psa:PST_2285)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMM3 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Psest_2040 alcohol ABC transporter, permease protein (Pseudomonas stutzeri RCH2)
MTIYWECLRGIVLREWLRFVQQRSRFFSALVRPLLWLVVFAAGFRAALGIAIIEPYDTYI
TYETYIVPGLACMILLFNGMQGSLSMVYDREMGSMRVLLTSPLPRSFLLASKLVAIALIS
LLQVYAFLAIAWFYGVQPPLLGLLVALPALLLVALLLSALGLLLSNGIRQLENFAGVMNF
VIFPMFFLSSALYPLWKMRDASEWLYWLCAINPFTHAVELVRNALYLRLAPAALVVCLGL
TLLFSLLAVISFNPQHAALRRSA