Protein Info for Psest_2032 in Pseudomonas stutzeri RCH2

Annotation: DNA segregation ATPase FtsK/SpoIIIE and related proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 801 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details PF13491: FtsK_4TM" amino acids 20 to 190 (171 residues), 133.9 bits, see alignment E=9.9e-43 PF17854: FtsK_alpha" amino acids 306 to 406 (101 residues), 113.3 bits, see alignment E=1.1e-36 PF01580: FtsK_SpoIIIE" amino acids 415 to 626 (212 residues), 257.3 bits, see alignment E=2.2e-80 PF09397: FtsK_gamma" amino acids 735 to 795 (61 residues), 88.9 bits, see alignment 2.9e-29

Best Hits

Swiss-Prot: 84% identical to FTSK_PSEAE: DNA translocase FtsK (ftsK) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03466, DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family (inferred from 96% identity to psa:PST_2293)

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKQ7 at UniProt or InterPro

Protein Sequence (801 amino acids)

>Psest_2032 DNA segregation ATPase FtsK/SpoIIIE and related proteins (Pseudomonas stutzeri RCH2)
MKNSSSTAPATVWRQQLHYRLKEGALIALGALCVYLWMALLTYDPGDPGWTHTSNIDQVR
NAAGRAGAWFADVLFMALGYFAYLFPLLLGVKTWQVFRARHQPWVWNGWLFSWRLIGLVF
LVLSGSALAYIHFQAAPGLPASAGGALGESLGQLAVLSLNVQGSTLALLAFFLFGLTVFT
DLSWFKVMDITGKITLDLIELIQSVFSRWWNARAERKQMVAQLREADDVVSEVAAPMVRD
RREQAKVKERIIERDEALAKHMSERDKRVAPVIAPPASPKPAEPSKRVLKEKQANLFVDP
LIEGSLPPISILDAAEKQQKQYSPESLEAMSRLLEIKLKEFGVEVIVESVHPGPVITRFE
IQPAAGVKVSRISNLAKDLARSLAVISVRVVEVIPGKTTVGIEIPNEDRQIVRFSEVLSS
APYDDAKSPVTLALGHDIGGKPVIADLAKMPHLLVAGTTGSGKSVGVNAMILSILFKSTP
EEARLIMIDPKMLELSIYEGIPHLLCPVVTDMKEAANALRWSVAEMERRYKLMAAMGVRN
LAGFNRKIKEAEEAGTPLHDPLYKRESMDDEPPYLKSLPTIVVVVDEFADMMMIVGKKVE
ELIARIAQKARAAGIHLILATQRPSVDVITGLIKANIPTRMAFQVSSKIDSRTILDQGGA
EQLLGHGDMLYLPPGTGLPIRVHGAFVSDEEVHRVVEAWKARGAPDYIEDILAGVEEAGS
GFDGGSGEGSGEGSEEDPLYDEAVRFVTESRRASISAVQRKLKIGYNRAARMIEAMEMAG
VVTSMNTNGSREVIAPPPMRD