Protein Info for PGA1_c20220 in Phaeobacter inhibens DSM 17395

Annotation: acetolactate synthase isozyme 3 small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00119: acetolactate synthase, small subunit
  • amino acids 28 to 186 (159 residues), 176.2 bits, E=2.4e-56
• PF01842: ACT
  • amino acids 29 to 91 (63 residues), 46 bits, E=7e-16
• PF22629: ACT_AHAS_ss
  • amino acids 31 to 98 (68 residues), 66.6 bits, E=3.6e-22
• PF13710: ACT_5
  • amino acids 38 to 100 (63 residues), 32.6 bits, E=1.1e-11
• PF10369: ALS_ss_C
  • amino acids 112 to 185 (74 residues), 89.4 bits, E=2.4e-29

Best Hits

Swiss-Prot: 48% identical to ILVH_ARCFU: Probable acetolactate synthase small subunit (ilvH) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: K01653, acetolactate synthase I/III small subunit [EC: 2.2.1.6] (inferred from 93% identity to sit:TM1040_0874)

MetaCyc: 49% identical to acetohydroxyacid synthase subunit H (Cupriavidus necator H16)
Acetolactate synthase. [EC: 2.2.1.6]; 2.2.1.6 [EC: 2.2.1.6]

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (12/13 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-valine biosynthesis (4/4 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• pyruvate fermentation to (R)-acetoin I (2/3 steps found)
• pyruvate fermentation to (S)-acetoin (2/3 steps found)
• L-isoleucine biosynthesis IV (4/6 steps found)
• pyruvate fermentation to (R)-acetoin II (1/2 steps found)
• L-isoleucine biosynthesis II (5/8 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• superpathway of 2,3-butanediol biosynthesis (3/6 steps found)
• superpathway of (R,R)-butanediol biosynthesis (2/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

See I7DRL0 at UniProt or InterPro

Protein Sequence (186 amino acids)

>PGA1_c20220 acetolactate synthase isozyme 3 small subunit (Phaeobacter inhibens DSM 17395)
MSALHIKKGSTSHSAYNLRPNFSDVQERHTITILVENEPGVLARVIGLFSGRGYNIDSLT
VAEVDHTGHLSRITIVTTGTPQVIEQIKAQLGRIVSVHEVTDLTVAGPFVERELAIVKVV
GEGEKRVEAMRLAEIFRAKVVDTTLNSFIFELTGAPDKIDAFAEMMRPLGLTKIARTGVA
ALLRGN