Protein Info for Psest_2029 in Pseudomonas stutzeri RCH2

Annotation: Putative arginyl-tRNA:protein arginylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 transmembrane" amino acids 153 to 173 (21 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details PF04376: ATE_N" amino acids 15 to 85 (71 residues), 82 bits, see alignment E=4.3e-27 PF13480: Acetyltransf_6" amino acids 81 to 206 (126 residues), 39 bits, see alignment E=1.3e-13 PF04377: ATE_C" amino acids 106 to 226 (121 residues), 148.4 bits, see alignment E=2.3e-47

Best Hits

Swiss-Prot: 96% identical to BPT_PSEU5: Aspartate/glutamate leucyltransferase (bpt) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00685, arginine-tRNA-protein transferase [EC: 2.3.2.8] (inferred from 96% identity to psa:PST_2296)

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIK8 at UniProt or InterPro

Protein Sequence (235 amino acids)

>Psest_2029 Putative arginyl-tRNA:protein arginylyltransferase (Pseudomonas stutzeri RCH2)
MTSLARLKFYATQPHACSYLPDEQATTLFLDPSQPMDAQVYAELSEMGFRRSGDHLYRPH
CQRCSACIPARIPVDAPALSRQQRRILKRNADLQVRCVRPAFSEELYTLYASYIEKRHAD
GDMYPPSREQFNTFLVRDLPFSRFYEFRLDGRLLAVAVTDVLPNGLSAVYTFYDPEEERR
SLGRYAILWQIGEAARLGLKAVYLGYWIKNCRKMNYKTEYRPIELLVNQRWVTLS