Protein Info for HP15_1939 in Marinobacter adhaerens HP15

Annotation: glycosyl transferase, group 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 PF20706: GT4-conflict" amino acids 153 to 345 (193 residues), 34.3 bits, see alignment E=2e-12 PF00534: Glycos_transf_1" amino acids 176 to 331 (156 residues), 92.6 bits, see alignment E=3.2e-30 PF13692: Glyco_trans_1_4" amino acids 180 to 321 (142 residues), 82.4 bits, see alignment E=5.9e-27

Best Hits

Predicted SEED Role

"FIG00784875: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQ23 at UniProt or InterPro

Protein Sequence (646 amino acids)

>HP15_1939 glycosyl transferase, group 1 (Marinobacter adhaerens HP15)
MPESDKPGFLEFIVPGDPEQNTGGYRYVRKLVEALGDAGCRARVSGLPGQFPRPDRVARN
GMDKKLASLPDGASVVLDGLAMGGLPEIVEKHSPRLNLIALVHHPLADETGISEANRQWF
FDSETRALGFVNGVITTSQHTAARLADYEVPAEMIRVAEPGVTRAANPIGCDQSSQTGTP
HILCVAHLSPRKAQHQLVEALENLKGVSWQCTLAGSDSRDPEYSQQVRRAIAEAGLEDRI
ALAGEVEEAGLAELYRKADLFVLPSLYEGYGMVIDEALAEGLPVISSDGGALANNSARPG
VVQYCAGDVRALEARLRNWLEHPEQLEHARKLAARESRRIRSWGDTGKDVLEALHYFSGL
STHLHQHSEFESTWLAAREAADHRARSQGLTDQLNQWLLNRYDGLSPESHYPMRIVDIGT
GRGSNALFLVPALQVPQTWLALDQDSALLREAGQRVDCLDVPFETRPVQLTSENMEQQLP
READLITASALIDLVSEPWLDALALAAAGRKSAMLIVLSYAGHFELSPEHPDDELVKTLV
NRHQHGDKGIGAALGPEASTVLQGLLVAEGYRVELAESPWILDGADHALAKMLMQGWIDA
AIEQSPHEADRLSRWLETRNQQLSKGDLKIVVRHLDLLALPPEALP